Lineage for d1mlcc1 (1mlc C:1-108)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (231 PDB entries)
    Uniprot P01645 1-106 # 95% sequense identity; KV5L_MOUSE Ig kappa chain V-V region HP 93G7 ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! SQ NA # humanized antibody ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01642 21-115 # ! KV5I_MOUSE Ig kappa chain V-V region L7 precursor
  8. Domain d1mlcc1: 1mlc C:1-108 [20054]
    Other proteins in same PDB: d1mlca2, d1mlcb1, d1mlcb2, d1mlcb3, d1mlcc2, d1mlcd1, d1mlcd2, d1mlcd3, d1mlce_, d1mlcf_
    part of Fab D44.1

Details for d1mlcc1

PDB Entry: 1mlc (more details), 2.5 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme
PDB Compounds: (C:) igg1-kappa d44.1 fab (light chain)

SCOPe Domain Sequences for d1mlcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlcc1 b.1.1.1 (C:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqspatlsvtpgdsvslscrasqsisnnlhwyqqkshesprllikyvsqsssgips
rfsgsgsgtdftlsinsvetedfgmyfcqqsnswprtfgggtkleikr

SCOPe Domain Coordinates for d1mlcc1 are not available.

Timeline for d1mlcc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mlcc2
View in 3D
Domains from other chains:
(mouse over for more information)
d1mlca1, d1mlca2, d1mlcb1, d1mlcb2, d1mlcb3, d1mlcd1, d1mlcd2, d1mlcd3, d1mlce_, d1mlcf_