Lineage for d3rycb1 (3ryc B:1-245)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1843633Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1843634Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 1843635Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins)
  6. 1843745Protein automated matches [226837] (6 species)
    not a true protein
  7. 1843814Species Sheep (Ovis aries) [TaxId:9940] [224884] (11 PDB entries)
  8. 1843820Domain d3rycb1: 3ryc B:1-245 [200539]
    Other proteins in same PDB: d3ryca2, d3rycb2, d3rycc2, d3rycd2, d3ryce_
    automated match to d1z2bb1
    complexed with gdp, gtp, mg, so4

Details for d3rycb1

PDB Entry: 3ryc (more details), 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d3rycb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rycb1 c.32.1.1 (B:1-245) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
mreivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneatgnkyv
prailvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvv
rkesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvmpspkvsdtvv
epynatlsvhqlventdetysidnealydicfrtlklttptygdlnhlvsatmsgvttcl
rfp

SCOPe Domain Coordinates for d3rycb1:

Click to download the PDB-style file with coordinates for d3rycb1.
(The format of our PDB-style files is described here.)

Timeline for d3rycb1: