Lineage for d3ryca2 (3ryc A:246-438)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1420571Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1420831Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 1420832Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
  6. 1420939Protein automated matches [227071] (2 species)
    not a true protein
  7. 1420985Species Sheep (Ovis aries) [TaxId:9940] [226224] (7 PDB entries)
  8. 1420990Domain d3ryca2: 3ryc A:246-438 [200538]
    Other proteins in same PDB: d3ryca1, d3rycb1, d3rycc1, d3rycd1, d3ryce_
    automated match to d1z2ba2
    complexed with gdp, gtp, mg, so4

Details for d3ryca2

PDB Entry: 3ryc (more details), 2.1 Å

PDB Description: Tubulin: RB3 stathmin-like domain complex
PDB Compounds: (A:) Tubulin alpha chain

SCOPe Domain Sequences for d3ryca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ryca2 d.79.2.1 (A:246-438) automated matches {Sheep (Ovis aries) [TaxId: 9940]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvd

SCOPe Domain Coordinates for d3ryca2:

Click to download the PDB-style file with coordinates for d3ryca2.
(The format of our PDB-style files is described here.)

Timeline for d3ryca2: