![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (28 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries) |
![]() | Domain d3rugh1: 3rug H:3-128 [200533] Other proteins in same PDB: d3ruga1, d3ruga2, d3ruga3, d3rugb_, d3rugc1, d3rugc2, d3rugc3, d3rugd_, d3ruge2, d3rugf2, d3rugg2, d3rugh2 automated match to d1ktke1 complexed with db6, nag |
PDB Entry: 3rug (more details), 2.2 Å
SCOPe Domain Sequences for d3rugh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rugh1 b.1.1.0 (H:3-128) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprskvavtggkvtlschqtnnhdymywyrqdtghglrlihysyvadstekgdipd gykasrpsqenfslilelaslsqtavyfcasrlggyeqyfgpgtrltvle
Timeline for d3rugh1: