Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (12 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
Domain d3rugg2: 3rug G:130-218 [200532] Other proteins in same PDB: d3ruga1, d3rugb_, d3rugc1, d3rugd_, d3ruge1, d3rugf1, d3rugg1, d3rugh1 automated match to d1qrnd2 complexed with db6, nag |
PDB Entry: 3rug (more details), 2.2 Å
SCOPe Domain Sequences for d3rugg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rugg2 b.1.1.2 (G:130-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d3rugg2: