SCOPe 2.08: Domain d3rugg2: 3rug G:130-218

Lineage for d3rugg2 (3rug G:130-218)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

Domain d3rugg2: 3rug G:130-218 [200532]
Other proteins in same PDB: d3ruga1, d3ruga2, d3ruga3, d3rugb_, d3rugc1, d3rugc2, d3rugc3, d3rugd_, d3ruge1, d3rugf1, d3rugg1, d3rugh1
automated match to d1qrnd2
complexed with db6, nag

Details for d3rugg2

PDB Entry: 3rug (more details), 2.2 Å

PDB Description: crystal structure of valpha10-vbeta8.1 nkt tcr in complex with cd1d- alphaglucosylceramide (c20:2)

PDB Compounds: (G:) Valpha10(mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rugg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rugg2 b.1.1.2 (G:130-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3rugg2:

Click to download the PDB-style file with coordinates for d3rugg2.
(The format of our PDB-style files is described here.)

Timeline for d3rugg2: