| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3rugg1: 3rug G:3-129 [200531] Other proteins in same PDB: d3ruga1, d3ruga2, d3ruga3, d3rugb_, d3rugc1, d3rugc2, d3rugc3, d3rugd_, d3ruge2, d3rugf2, d3rugg2, d3rugh2 automated match to d1qrnd1 complexed with db6, nag |
PDB Entry: 3rug (more details), 2.2 Å
SCOPe Domain Sequences for d3rugg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rugg1 b.1.1.0 (G:3-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspswaeqrggrlts
saasnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpn
Timeline for d3rugg1: