Lineage for d3rugc2 (3rug C:186-279)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2746777Protein CD1, alpha-3 domain [88615] (5 species)
  7. 2746809Species Mouse (Mus musculus) [TaxId:10090] [88616] (12 PDB entries)
  8. 2746815Domain d3rugc2: 3rug C:186-279 [200526]
    Other proteins in same PDB: d3ruga1, d3ruga3, d3rugb_, d3rugc1, d3rugc3, d3rugd_, d3ruge1, d3ruge2, d3rugf1, d3rugf2, d3rugg1, d3rugg2, d3rugh1, d3rugh2
    automated match to d1gzqa1
    complexed with db6, nag

Details for d3rugc2

PDB Entry: 3rug (more details), 2.2 Å

PDB Description: crystal structure of valpha10-vbeta8.1 nkt tcr in complex with cd1d- alphaglucosylceramide (c20:2)
PDB Compounds: (C:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3rugc2:

Sequence, based on SEQRES records: (download)

>d3rugc2 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3rugc2 b.1.1.2 (C:186-279) CD1, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3rugc2:

Click to download the PDB-style file with coordinates for d3rugc2.
(The format of our PDB-style files is described here.)

Timeline for d3rugc2: