Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries) |
Domain d3ruga1: 3rug A:8-185 [200522] Other proteins in same PDB: d3ruga2, d3rugb_, d3rugc2, d3rugd_, d3ruge1, d3ruge2, d3rugf1, d3rugf2, d3rugg1, d3rugg2, d3rugh1, d3rugh2 automated match to d1gzpa2 complexed with db6, nag |
PDB Entry: 3rug (more details), 2.2 Å
SCOPe Domain Sequences for d3ruga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ruga1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3ruga1: