Lineage for d3ruga1 (3rug A:8-185)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1641761Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1641762Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1642705Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1642706Protein automated matches [226842] (4 species)
    not a true protein
  7. 1642765Species Mouse (Mus musculus) [TaxId:10090] [224924] (31 PDB entries)
  8. 1642772Domain d3ruga1: 3rug A:8-185 [200522]
    Other proteins in same PDB: d3ruga2, d3rugb_, d3rugc2, d3rugd_, d3ruge1, d3ruge2, d3rugf1, d3rugf2, d3rugg1, d3rugg2, d3rugh1, d3rugh2
    automated match to d1gzpa2
    complexed with db6, nag

Details for d3ruga1

PDB Entry: 3rug (more details), 2.2 Å

PDB Description: crystal structure of valpha10-vbeta8.1 nkt tcr in complex with cd1d- alphaglucosylceramide (c20:2)
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3ruga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ruga1 d.19.1.0 (A:8-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqweklq
hmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvvr
fwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3ruga1:

Click to download the PDB-style file with coordinates for d3ruga1.
(The format of our PDB-style files is described here.)

Timeline for d3ruga1: