SCOPe 2.03: Domain d3rtqd2: 3rtq D:113-240

Lineage for d3rtqd2 (3rtq D:113-240)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d3rtqd2: 3rtq D:113-240 [200521]
   Other proteins in same PDB: d3rtqa1, d3rtqa2, d3rtqb_, d3rtqc2, d3rtqd1
   automated match to d1lp9f2
   complexed with h4s, nag

Details for d3rtqd2

PDB Entry: 3rtq, 2.8 Å

PDB Description: structure of the mouse cd1d-hs44-inkt tcr complex

PDB Compounds: (D:) V beta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rtqd2:

Sequence; same for both SEQRES and ATOM records:

>d3rtqd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Timeline for d3rtqd2:

• d3rtqd2 is new in SCOPe 2.03-stable
  
• d3rtqd2 appears in SCOPe 2.04
  
• d3rtqd2 appears in the current release, SCOPe 2.08