Lineage for d3rsed2 (3rse D:121-282)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445470Fold d.198: Secretion chaperone-like [69634] (5 superfamilies)
    alpha-beta(3)-alpha-beta(2)-alpha; 2 layers: alpha/beta
  4. 1445552Superfamily d.198.2: Arp2/3 complex subunits [69645] (1 family) (S)
  5. 1445553Family d.198.2.1: Arp2/3 complex subunits [69646] (2 proteins)
  6. 1445554Protein ARPC2 (34 kDa subunit) [69649] (1 species)
    duplication: tandem repeat of two domains of this fold
  7. 1445555Species Cow (Bos taurus) [TaxId:9913] [69650] (16 PDB entries)
    Uniprot O15144 1-282 # 100% sequence identity
  8. 1445587Domain d3rsed2: 3rse D:121-282 [200511]
    Other proteins in same PDB: d3rsea1, d3rsea2, d3rseb_, d3rsec_, d3rsee_, d3rsef_, d3rseg_
    automated match to d1k8kd2

Details for d3rsed2

PDB Entry: 3rse (more details), 2.65 Å

PDB Description: Structural and biochemical characterization of two binding sites for nucleation promoting factor WASp-VCA on Arp2/3 complex
PDB Compounds: (D:) Actin-related protein 2/3 complex subunit 2

SCOPe Domain Sequences for d3rsed2:

Sequence, based on SEQRES records: (download)

>d3rsed2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshrepplelkdtdaavgdnigyitfvlfprhtnasardnt
inlihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

Sequence, based on observed residues (ATOM records): (download)

>d3rsed2 d.198.2.1 (D:121-282) ARPC2 (34 kDa subunit) {Cow (Bos taurus) [TaxId: 9913]}
fasvfekyfqfqeegkegenravihyrddetmyveskkdrvtvvfstvfkddddvvigkv
fmqefkegrrashtapqvlfshreppledtdaavgdnigyitfvlfprhtnasardntin
lihtfrdylhyhikcskayihtrmraktsdflkvlnrarp

SCOPe Domain Coordinates for d3rsed2:

Click to download the PDB-style file with coordinates for d3rsed2.
(The format of our PDB-style files is described here.)

Timeline for d3rsed2: