SCOP 1.63: Domain d1mlbb1: 1mlb B:1-118

Lineage for d1mlbb1 (1mlb B:1-118)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab D44.1 (mouse), kappa L chain [48803] (2 PDB entries)

8. Domain d1mlbb1: 1mlb B:1-118 [20051]
   Other proteins in same PDB: d1mlba2, d1mlbb2

Details for d1mlbb1

PDB Entry: 1mlb, 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme

SCOP Domain Sequences for d1mlbb1:

Sequence; same for both SEQRES and ATOM records:

>d1mlbb1 b.1.1.1 (B:1-118) Immunoglobulin (variable domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
qvqlqesgaevmkpgasvkisckatgytfstywiewvkqrpghglewigeilpgsgstyy
nekfkgkatftadtssntaymqlssltsedsavyycargdgnygywgqgttltvssas

Timeline for d1mlbb1:

• d1mlbb1 first appeared (with stable ids) in SCOP 1.55
  
• d1mlbb1 appears in SCOP 1.61
  
• d1mlbb1 appears in SCOP 1.65
  
• d1mlbb1 appears in the current release, SCOPe 2.08