Lineage for d1ibgl1 (1ibg L:2-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930839Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
  8. 930859Domain d1ibgl1: 1ibg L:2-107 [20048]
    Other proteins in same PDB: d1ibgh1, d1ibgh2, d1ibgl2
    part of Fab 40-50
    complexed with cu, obn

Details for d1ibgl1

PDB Entry: 1ibg (more details), 2.7 Å

PDB Description: structure and specificity of the anti-digoxin antibody 40-50
PDB Compounds: (L:) igg2b-kappa 40-50 fab (light chain)

SCOPe Domain Sequences for d1ibgl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibgl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
ivltqspaslavslgqratiscrasksvstsgyshihwyqqkpgqppklliylasilesg
vparfsgsgsgtdftlnihpveeedaatyycqhsreypltfgagtelelk

SCOPe Domain Coordinates for d1ibgl1:

Click to download the PDB-style file with coordinates for d1ibgl1.
(The format of our PDB-style files is described here.)

Timeline for d1ibgl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ibgl2