SCOPe 2.06: Domain d3rgvc2: 3rgv C:182-275

Lineage for d3rgvc2 (3rgv C:182-275)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein Class I MHC, alpha-3 domain [88604] (4 species)
Species Mouse (Mus musculus) [TaxId:10090] [88606] (109 PDB entries)
Uniprot P01901 22-299
Domain d3rgvc2: 3rgv C:182-275 [200476]
Other proteins in same PDB: d3rgva1, d3rgva2, d3rgvb1, d3rgvb2, d3rgvc1, d3rgvd1, d3rgvd2
automated match to d2fwoa1

Details for d3rgvc2

PDB Entry: 3rgv (more details), 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers

PDB Compounds: (C:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d3rgvc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgvc2 b.1.1.2 (C:182-275) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrwe

SCOPe Domain Coordinates for d3rgvc2:

Click to download the PDB-style file with coordinates for d3rgvc2.
(The format of our PDB-style files is described here.)

Timeline for d3rgvc2: