Lineage for d3rgvb2 (3rgv B:113-236)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2352435Protein automated matches [190374] (14 species)
    not a true protein
  7. 2353824Species Mouse (Mus musculus) [TaxId:10090] [224855] (510 PDB entries)
  8. 2354322Domain d3rgvb2: 3rgv B:113-236 [200474]
    Other proteins in same PDB: d3rgva1, d3rgvb1, d3rgvc1, d3rgvc2, d3rgvd1, d3rgvd2
    automated match to d1qsee2

Details for d3rgvb2

PDB Entry: 3rgv (more details), 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers
PDB Compounds: (B:) Yae62 TCR b chain

SCOPe Domain Sequences for d3rgvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgvb2 b.1.1.2 (B:113-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeaw

SCOPe Domain Coordinates for d3rgvb2:

Click to download the PDB-style file with coordinates for d3rgvb2.
(The format of our PDB-style files is described here.)

Timeline for d3rgvb2: