Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries) |
Domain d3rgvb1: 3rgv B:1-112 [200473] Other proteins in same PDB: d3rgva2, d3rgvb2, d3rgvc1, d3rgvc2, d3rgvd1, d3rgvd2 automated match to d1qrne1 |
PDB Entry: 3rgv (more details), 2.9 Å
SCOPe Domain Sequences for d3rgvb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgvb1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvled
Timeline for d3rgvb1: