SCOPe 2.04: Domain d3rgvb1: 3rgv B:1-112

Lineage for d3rgvb1 (3rgv B:1-112)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d3rgvb1: 3rgv B:1-112 [200473]
   Other proteins in same PDB: d3rgva2, d3rgvb2, d3rgvc1, d3rgvc2, d3rgvd_
   automated match to d1qrne1

Details for d3rgvb1

PDB Entry: 3rgv, 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers

PDB Compounds: (B:) Yae62 TCR b chain

SCOPe Domain Sequences for d3rgvb1:

Sequence; same for both SEQRES and ATOM records:

>d3rgvb1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvled

Timeline for d3rgvb1:

• d3rgvb1 first appeared in SCOPe 2.03
  
• d3rgvb1 appears in SCOPe 2.05
  
• d3rgvb1 appears in the current release, SCOPe 2.08