Lineage for d3rgvb1 (3rgv B:1-112)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1296776Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)
  8. 1297184Domain d3rgvb1: 3rgv B:1-112 [200473]
    Other proteins in same PDB: d3rgva2, d3rgvb2, d3rgvc1, d3rgvc2, d3rgvd_
    automated match to d1qrne1

Details for d3rgvb1

PDB Entry: 3rgv (more details), 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers
PDB Compounds: (B:) Yae62 TCR b chain

SCOPe Domain Sequences for d3rgvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rgvb1 b.1.1.0 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
gykasrpsqenfslilelatpsqtsvyfcasgdfwgdtlyfgagtrlsvled

SCOPe Domain Coordinates for d3rgvb1:

Click to download the PDB-style file with coordinates for d3rgvb1.
(The format of our PDB-style files is described here.)

Timeline for d3rgvb1: