Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d3rgva2: 3rgv A:111-200 [200472] Other proteins in same PDB: d3rgva1, d3rgvb1, d3rgvc1, d3rgvc2, d3rgvd1, d3rgvd2 automated match to d1qrnd2 |
PDB Entry: 3rgv (more details), 2.9 Å
SCOPe Domain Sequences for d3rgva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rgva2 b.1.1.2 (A:111-200) automated matches {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d3rgva2: