SCOPe 2.07: Domain d3rgva1: 3rgv A:1-110

Lineage for d3rgva1 (3rgv A:1-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3rgva1: 3rgv A:1-110 [200471]
   Other proteins in same PDB: d3rgva2, d3rgvb2, d3rgvc1, d3rgvc2, d3rgvd1, d3rgvd2
   automated match to d1qrnd1

Details for d3rgva1

PDB Entry: 3rgv, 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers

PDB Compounds: (A:) Yae62 TCR a chain

SCOPe Domain Sequences for d3rgva1:

Sequence; same for both SEQRES and ATOM records:

>d3rgva1 b.1.1.0 (A:1-110) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dsvtqmqgqvtlsendflfinctysttgyptlfwyvqysgegpqlllqvttannkgssrg
featydkgttsfhlqktsvqeidsavyycaansgtyqrfgtgtklqvvpn

Timeline for d3rgva1:

• d3rgva1 first appeared in SCOPe 2.03
  
• d3rgva1 appears in SCOPe 2.06
  
• d3rgva1 appears in the current release, SCOPe 2.08