SCOP 1.69: Domain d1igch1: 1igc H:1-119

Lineage for d1igch1 (1igc H:1-119)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (49 PDB entries)

8. Domain d1igch1: 1igc H:1-119 [20047]
   Other proteins in same PDB: d1igca_, d1igch2, d1igcl1, d1igcl2
   part of Fab MoPC21

Details for d1igch1

PDB Entry: 1igc, 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igch1:

Sequence; same for both SEQRES and ATOM records:

>d1igch1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2}
dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstlhy
adtvkgrftisrdnpkntlflqmtslrsedtgmyycarwgnypyyamdywgqgtsvtvs

Timeline for d1igch1:

• d1igch1 first appeared (with stable ids) in SCOP 1.55
  
• d1igch1 appears in SCOP 1.67
  
• d1igch1 appears in SCOP 1.71
  
• d1igch1 appears in the current release, SCOPe 2.08