SCOP 1.55: Domain d1igch1: 1igc H:1-119

Lineage for d1igch1 (1igc H:1-119)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species Fab MoPC21 (mouse), kappa L chain [48801] (1 PDB entry)

8. Domain d1igch1: 1igc H:1-119 [20047]
   Other proteins in same PDB: d1igca_, d1igch2, d1igcl2

Details for d1igch1

PDB Entry: 1igc, 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igch1:

Sequence; same for both SEQRES and ATOM records:

>d1igch1 b.1.1.1 (H:1-119) Immunoglobulin (variable domains of L and H chains) {Fab MoPC21 (mouse), kappa L chain}
dvqlvesggglvqpggsrklscaasgftfssfgmhwvrqapekglewvayissgsstlhy
adtvkgrftisrdnpkntlflqmtslrsedtgmyycarwgnypyyamdywgqgtsvtvs

Timeline for d1igch1:

• d1igch1 appears in SCOP 1.57
  
• d1igch1 appears in the current release, SCOPe 2.08