Lineage for d3reab_ (3rea B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377218Protein Hemapoetic cell kinase Hck [50062] (1 species)
  7. 2377219Species Human (Homo sapiens) [TaxId:9606] [50063] (26 PDB entries)
  8. 2377220Domain d3reab_: 3rea B: [200469]
    Other proteins in same PDB: d3reaa_, d3reac_
    automated match to d5hcka_

Details for d3reab_

PDB Entry: 3rea (more details), 2 Å

PDB Description: HIV-1 Nef protein in complex with engineered Hck-SH3 domain
PDB Compounds: (B:) Tyrosine-protein kinase HCK

SCOPe Domain Sequences for d3reab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3reab_ b.34.2.1 (B:) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]}
ediivvalydyvswspddlsfqkgdqmvvleesgewwkarslatrkegyipsnyvarvds

SCOPe Domain Coordinates for d3reab_:

Click to download the PDB-style file with coordinates for d3reab_.
(The format of our PDB-style files is described here.)

Timeline for d3reab_: