Lineage for d3r8rg_ (3r8r G:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1342158Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 1343361Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 1343362Protein automated matches [190115] (51 species)
    not a true protein
  7. 1343421Species Bacillus subtilis [TaxId:1423] [193173] (1 PDB entry)
  8. 1343428Domain d3r8rg_: 3r8r G: [200453]
    automated match to d3r8rp_
    complexed with gol, so4

Details for d3r8rg_

PDB Entry: 3r8r (more details), 1.9 Å

PDB Description: transaldolase from bacillus subtilis
PDB Compounds: (G:) Transaldolase

SCOPe Domain Sequences for d3r8rg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r8rg_ c.1.10.0 (G:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlffvdtanideireanelgilagvttnpslvakeanvsfhdrlreitdvvkgsvsaevi
slkaeemieegkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaa
ragatyvspflgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrga
higtmplkvihaltkhpltdkgieqfladwnk

SCOPe Domain Coordinates for d3r8rg_:

Click to download the PDB-style file with coordinates for d3r8rg_.
(The format of our PDB-style files is described here.)

Timeline for d3r8rg_: