| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (51 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [193173] (1 PDB entry) |
| Domain d3r8rg_: 3r8r G: [200453] automated match to d3r8rp_ complexed with gol, so4 |
PDB Entry: 3r8r (more details), 1.9 Å
SCOPe Domain Sequences for d3r8rg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r8rg_ c.1.10.0 (G:) automated matches {Bacillus subtilis [TaxId: 1423]}
mlffvdtanideireanelgilagvttnpslvakeanvsfhdrlreitdvvkgsvsaevi
slkaeemieegkelakiapnitvkipmtsdglkavraltdlgiktnvtlifnanqallaa
ragatyvspflgrlddighngldlisevkqifdihgldtqiiaasirhpqhvteaalrga
higtmplkvihaltkhpltdkgieqfladwnk
Timeline for d3r8rg_: