![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
![]() | Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins) |
![]() | Protein Staphylococcal enterotoxin B, SEB [54342] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries) |
![]() | Domain d3r8bo2: 3r8b O:122-239 [200446] Other proteins in same PDB: d3r8ba1, d3r8bb_, d3r8bc1, d3r8bd_, d3r8be1, d3r8bf_, d3r8bg1, d3r8bh_, d3r8bi1, d3r8bj_, d3r8bk1, d3r8bl_, d3r8bm1, d3r8bn_, d3r8bo1, d3r8bp_ automated match to d1se4a2 complexed with cl, so4, zn |
PDB Entry: 3r8b (more details), 2.95 Å
SCOPe Domain Sequences for d3r8bo2:
Sequence, based on SEQRES records: (download)
>d3r8bo2 d.15.6.1 (O:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk
>d3r8bo2 d.15.6.1 (O:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]} ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk
Timeline for d3r8bo2: