SCOPe 2.07: Domain d3r8bo1: 3r8b O:2-121

Lineage for d3r8bo1 (3r8b O:2-121)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families)

5. Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)

8. Domain d3r8bo1: 3r8b O:2-121 [200445]
   Other proteins in same PDB: d3r8ba2, d3r8bb_, d3r8bc2, d3r8bd_, d3r8be2, d3r8bf_, d3r8bg2, d3r8bh_, d3r8bi2, d3r8bj_, d3r8bk2, d3r8bl_, d3r8bm2, d3r8bn_, d3r8bo2, d3r8bp_
   automated match to d1se4a1
   complexed with cl, so4, zn

Details for d3r8bo1

PDB Entry: 3r8b, 2.95 Å

PDB Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8

PDB Compounds: (O:) enterotoxin type b

SCOPe Domain Sequences for d3r8bo1:

Sequence, based on SEQRES records:

>d3r8bo1 b.40.2.2 (O:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records):

>d3r8bo1 b.40.2.2 (O:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvteh

Timeline for d3r8bo1:

• d3r8bo1 first appeared in SCOPe 2.03
  
• d3r8bo1 appears in SCOPe 2.06
  
• d3r8bo1 appears in the current release, SCOPe 2.08