SCOPe 2.08: Domain d3r8bm2: 3r8b M:122-239

Lineage for d3r8bm2 (3r8b M:122-239)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [54343] (18 PDB entries)

8. Domain d3r8bm2: 3r8b M:122-239 [200444]
   Other proteins in same PDB: d3r8ba1, d3r8bb_, d3r8bc1, d3r8bd_, d3r8be1, d3r8bf_, d3r8bg1, d3r8bh_, d3r8bi1, d3r8bj_, d3r8bk1, d3r8bl_, d3r8bm1, d3r8bn_, d3r8bo1, d3r8bp_
   automated match to d1se4a2
   complexed with cl, so4, zn

Details for d3r8bm2

PDB Entry: 3r8b, 2.95 Å

PDB Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8

PDB Compounds: (M:) enterotoxin type b

SCOPe Domain Sequences for d3r8bm2:

Sequence, based on SEQRES records:

>d3r8bm2 d.15.6.1 (M:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkkk

Sequence, based on observed residues (ATOM records):

>d3r8bm2 d.15.6.1 (M:122-239) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttkk

Timeline for d3r8bm2:

• d3r8bm2 first appeared in SCOPe 2.03
  
• d3r8bm2 appears in SCOPe 2.07