SCOP 1.67: Domain d1nqbc1: 1nqb C:2-120

Lineage for d1nqbc1 (1nqb C:2-120)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (141 PDB entries)

8. Domain d1nqbc1: 1nqb C:2-120 [20044]
   Other proteins in same PDB: d1nqba2, d1nqbc2
   part of scFv trivalent antibody; N-terminal, VH domain is from B1-8 antibody (1A6U CH H); C-terminal, VL domain is from NQ11 antibody

Details for d1nqbc1

PDB Entry: 1nqb, 2 Å

PDB Description: trivalent antibody fragment

SCOP Domain Sequences for d1nqbc1:

Sequence; same for both SEQRES and ATOM records:

>d1nqbc1 b.1.1.1 (C:2-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

Timeline for d1nqbc1:

• d1nqbc1 first appeared (with stable ids) in SCOP 1.55
  
• d1nqbc1 appears in SCOP 1.65
  
• d1nqbc1 appears in SCOP 1.69
  
• d1nqbc1 appears in the current release, SCOPe 2.08