SCOPe 2.06: Domain d3r27a_: 3r27 A:

Lineage for d3r27a_ (3r27 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (87 PDB entries)

8. Domain d3r27a_: 3r27 A: [200430]
   automated match to d3r27b_
   complexed with gol

Details for d3r27a_

PDB Entry: 3r27, 2.04 Å

PDB Description: Crystal structure of the first RRM domain of heterogeneous nuclear ribonucleoprotein L (HnRNP L)

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein L

SCOPe Domain Sequences for d3r27a_:

Sequence; same for both SEQRES and ATOM records:

>d3r27a_ d.58.7.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ktpaspvvhirglidgvveadlvealqefgpisyvvvmpkkrqalvefedvlgacnavny
aadnqiyiaghpafvnystsqkis

Timeline for d3r27a_:

• d3r27a_ first appeared in SCOPe 2.03
  
• d3r27a_ appears in SCOPe 2.05
  
• d3r27a_ appears in SCOPe 2.07
  
• d3r27a_ appears in the current release, SCOPe 2.08