| Class b: All beta proteins [48724] (93 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins) |
| Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species) |
| Species scFv trivalent antibody, based on: (mouse), kappa L chain [48800] (1 PDB entry) |
| Domain d1nqba2: 1nqb A:121-233 [20043] |
PDB Entry: 1nqb (more details), 2 Å
SCOP Domain Sequences for d1nqba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqba2 b.1.1.1 (A:121-233) Immunoglobulin (variable domains of L and H chains) {scFv trivalent antibody, based on: (mouse), kappa L chain}
dieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
Timeline for d1nqba2: