![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species) VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (132 PDB entries) Uniprot P01631 #KV2G_MOUSE Ig kappa chain V-II region 26-10; 79% sequence identity ! Uniprot P06310 # KV2F_HUMAN IG KAPPA CHAIN V-II REGION RPMI 6410 PRECURSOR ! Uniprot P03976 # KV2E_MOUSE (P03976) Ig kappa chain V-II region 17S29.1 ! Uniprot P01642 21-115 # ! KV2G_MOUSE IG KAPPA CHAIN V-II REGION 26-10 |
![]() | Domain d1nqba2: 1nqb A:121-233 [20043] Other proteins in same PDB: d1nqba1, d1nqbc1 part of scFv trivalent antibody; N-terminal, VH domain is from B1-8 antibody (1A6U CH H); C-terminal, VL domain is from NQ11 antibody |
PDB Entry: 1nqb (more details), 2 Å
SCOPe Domain Sequences for d1nqba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nqba2 b.1.1.1 (A:121-233) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} dieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr
Timeline for d1nqba2: