Lineage for d1nqba1 (1nqb A:2-120)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288122Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1288147Domain d1nqba1: 1nqb A:2-120 [20042]
    Other proteins in same PDB: d1nqba2, d1nqbc2
    part of scFv trivalent antibody; N-terminal, VH domain is from B1-8 antibody (1A6U CH H); C-terminal, VL domain is from NQ11 antibody

Details for d1nqba1

PDB Entry: 1nqb (more details), 2 Å

PDB Description: trivalent antibody fragment
PDB Compounds: (A:) single-chain antibody fragment

SCOPe Domain Sequences for d1nqba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqba1 b.1.1.1 (A:2-120) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

SCOPe Domain Coordinates for d1nqba1:

Click to download the PDB-style file with coordinates for d1nqba1.
(The format of our PDB-style files is described here.)

Timeline for d1nqba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nqba2