SCOP 1.57: Domain d1nqba1: 1nqb A:2-120

Lineage for d1nqba1 (1nqb A:2-120)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species scFv trivalent antibody, based on: (mouse), kappa L chain [48800] (1 PDB entry)

8. Domain d1nqba1: 1nqb A:2-120 [20042]

Details for d1nqba1

PDB Entry: 1nqb, 2 Å

PDB Description: trivalent antibody fragment

SCOP Domain Sequences for d1nqba1:

Sequence; same for both SEQRES and ATOM records:

>d1nqba1 b.1.1.1 (A:2-120) Immunoglobulin (variable domains of L and H chains) {scFv trivalent antibody, based on: (mouse), kappa L chain}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

Timeline for d1nqba1:

• d1nqba1 first appeared (with stable ids) in SCOP 1.55
  
• d1nqba1 appears in SCOP 1.59
  
• d1nqba1 appears in the current release, SCOPe 2.07