| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (12 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [224855] (237 PDB entries) |
| Domain d3qwob2: 3qwo B:108-211 [200418] Other proteins in same PDB: d3qwob1, d3qwoc_, d3qwol1, d3qwop_ automated match to d1rhha2 complexed with edo, so4 |
PDB Entry: 3qwo (more details), 1.9 Å
SCOPe Domain Sequences for d3qwob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qwob2 b.1.1.2 (B:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d3qwob2:
View in 3DDomains from other chains: (mouse over for more information) d3qwoc_, d3qwol1, d3qwol2, d3qwop_ |