| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.5: PAPS sulfotransferase [52575] (15 proteins) Pfam PF00685 similar to the nucleotide/nucleoside kinases but transfer sulphate group |
| Protein automated matches [190189] (4 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [186928] (11 PDB entries) |
| Domain d3qvua_: 3qvu A: [200416] automated match to d3qvub_ complexed with a3p, edo, npo |
PDB Entry: 3qvu (more details), 2.5 Å
SCOPe Domain Sequences for d3qvua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvua_ c.37.1.5 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
srqpleyvkgvplikyfaealgplqsfqarpddllistypksgttwvsqildmiyqggdl
ekchrapifnrvpflefkapgipsgmetlkdtpaprllkthlplallpqtlldqkvkvvy
varnakdvavsyyhfyhmakvhpdpgtwdsflekfmvgevcygswyqhvqewwelsrthp
vlylfyedmkenpkreiqkilefvghslpeetvdfmvqhtsfkemkknpmtnyttipqei
mdhsispfmrkgmagdwkttftvaqnerfdadyaekmagcslsfrsel
Timeline for d3qvua_: