| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.18: PLC-like phosphodiesterases [51695] (4 families) ![]() |
| Family c.1.18.0: automated matches [191539] (1 protein) not a true family |
| Protein automated matches [190919] (11 species) not a true protein |
| Species Oleispira antarctica [TaxId:188908] [196362] (1 PDB entry) |
| Domain d3qvqc_: 3qvq C: [200415] automated match to d3qvqd_ complexed with cl, edo, g3p, mg, na, ni, peg |
PDB Entry: 3qvq (more details), 1.6 Å
SCOPe Domain Sequences for d3qvqc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qvqc_ c.1.18.0 (C:) automated matches {Oleispira antarctica [TaxId: 188908]}
qsaysflpqviahrgssgqapentlaslhlagqqgikwveidvmlsgdgipvifhddyls
rttdgdgliyktplaelkqldagswkgqeyqqetiptlleaievisqygmglnlelkpce
gleeetiaasvevlkqhwpqdlpllfssfnyfalvsakalwpeiargynvsaipsawqer
lehldcaglhihqsffdvqqvsdikaagykvlaftindeslalklynqgldavfsdypqk
iqsaidshin
Timeline for d3qvqc_: