SCOPe 2.08: Domain d3qvac_: 3qva C:

Lineage for d3qvac_ (3qva C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.3: Prealbumin-like [49451] (8 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.0: automated matches [191441] (1 protein)
   not a true family

6. Protein automated matches [190651] (8 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry)

8. Domain d3qvac_: 3qva C: [200412]
   Other proteins in same PDB: d3qvaa2, d3qvab2
   automated match to d3qvad_
   complexed with po4

Details for d3qvac_

PDB Entry: 3qva, 1.76 Å

PDB Description: structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase

PDB Compounds: (C:) transthyretin-like protein

SCOPe Domain Sequences for d3qvac_:

Sequence, based on SEQRES records:

>d3qvac_ b.3.4.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltae
tgawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrgs

Sequence, based on observed residues (ATOM records):

>d3qvac_ b.3.4.0 (C:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltae
tgawfaragresvftraqidfvigedhfhlpfliapggwstyrgs

Timeline for d3qvac_:

• d3qvac_ first appeared in SCOPe 2.03
  
• d3qvac_ appears in SCOPe 2.07