Lineage for d3qvab_ (3qva B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1772695Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 1772955Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 1773528Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 1773529Protein automated matches [190651] (7 species)
    not a true protein
  7. 1773554Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry)
  8. 1773556Domain d3qvab_: 3qva B: [200411]
    automated match to d3qvad_
    complexed with po4

Details for d3qvab_

PDB Entry: 3qva (more details), 1.75 Å

PDB Description: structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase
PDB Compounds: (B:) transthyretin-like protein

SCOPe Domain Sequences for d3qvab_:

Sequence, based on SEQRES records: (download)

>d3qvab_ b.3.4.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
hmstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagryclta
etgawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrg

Sequence, based on observed residues (ATOM records): (download)

>d3qvab_ b.3.4.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
hmstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagryclta
etgawfaragresvftraqidfvigedhfhlpfliapggwstyrg

SCOPe Domain Coordinates for d3qvab_:

Click to download the PDB-style file with coordinates for d3qvab_.
(The format of our PDB-style files is described here.)

Timeline for d3qvab_: