Class b: All beta proteins [48724] (176 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (7 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry) |
Domain d3qvab_: 3qva B: [200411] automated match to d3qvad_ complexed with po4 |
PDB Entry: 3qva (more details), 1.75 Å
SCOPe Domain Sequences for d3qvab_:
Sequence, based on SEQRES records: (download)
>d3qvab_ b.3.4.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]} hmstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagryclta etgawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrg
>d3qvab_ b.3.4.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 272620]} hmstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagryclta etgawfaragresvftraqidfvigedhfhlpfliapggwstyrg
Timeline for d3qvab_: