Lineage for d3qvaa1 (3qva A:1-108)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2768597Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2768957Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2769733Family b.3.4.0: automated matches [191441] (1 protein)
    not a true family
  6. 2769734Protein automated matches [190651] (8 species)
    not a true protein
  7. 2769782Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry)
  8. 2769783Domain d3qvaa1: 3qva A:1-108 [200410]
    Other proteins in same PDB: d3qvaa2, d3qvab2
    automated match to d3qvad_
    complexed with po4

Details for d3qvaa1

PDB Entry: 3qva (more details), 1.76 Å

PDB Description: structure of klebsiella pneumoniae 5-hydroxyisourate hydrolase
PDB Compounds: (A:) transthyretin-like protein

SCOPe Domain Sequences for d3qvaa1:

Sequence, based on SEQRES records: (download)

>d3qvaa1 b.3.4.0 (A:1-108) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltae
tgawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrgs

Sequence, based on observed residues (ATOM records): (download)

>d3qvaa1 b.3.4.0 (A:1-108) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
mstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltae
tgawfaragresvftraqidfvidhfhlpfliapggwstyrgs

SCOPe Domain Coordinates for d3qvaa1:

Click to download the PDB-style file with coordinates for d3qvaa1.
(The format of our PDB-style files is described here.)

Timeline for d3qvaa1: