Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) |
Family b.3.4.0: automated matches [191441] (1 protein) not a true family |
Protein automated matches [190651] (8 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [196215] (1 PDB entry) |
Domain d3qvaa1: 3qva A:1-108 [200410] Other proteins in same PDB: d3qvaa2, d3qvab2 automated match to d3qvad_ complexed with po4 |
PDB Entry: 3qva (more details), 1.76 Å
SCOPe Domain Sequences for d3qvaa1:
Sequence, based on SEQRES records: (download)
>d3qvaa1 b.3.4.0 (A:1-108) automated matches {Klebsiella pneumoniae [TaxId: 272620]} mstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltae tgawfaragresvftraqidfvigeaaedhfhlpfliapggwstyrgs
>d3qvaa1 b.3.4.0 (A:1-108) automated matches {Klebsiella pneumoniae [TaxId: 272620]} mstlsthildistgtpaegvtvslsregetlanlvtnaqgriatfsaaplpagrycltae tgawfaragresvftraqidfvidhfhlpfliapggwstyrgs
Timeline for d3qvaa1:
View in 3D Domains from other chains: (mouse over for more information) d3qvab1, d3qvab2, d3qvac_, d3qvad_ |