Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry) |
Domain d1lmkg2: 1lmk G:201-312 [20041] |
PDB Entry: 1lmk (more details), 2.6 Å
SCOP Domain Sequences for d1lmkg2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmkg2 b.1.1.1 (G:201-312) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain} dieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliykvstrf sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk
Timeline for d1lmkg2: