SCOP 1.61: Domain d1lmkg2: 1lmk G:201-312

Lineage for d1lmkg2 (1lmk G:201-312)

Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (6 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry)
Domain d1lmkg2: 1lmk G:201-312 [20041]

Details for d1lmkg2

PDB Entry: 1lmk (more details), 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmkg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmkg2 b.1.1.1 (G:201-312) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain}
dieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliykvstrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk

SCOP Domain Coordinates for d1lmkg2:

Click to download the PDB-style file with coordinates for d1lmkg2.
(The format of our PDB-style files is described here.)

Timeline for d1lmkg2: