Lineage for d3quzc2 (3quz C:118-206)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2752318Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
  8. 2752680Domain d3quzc2: 3quz C:118-206 [200407]
    Other proteins in same PDB: d3quza1, d3quzb_, d3quzc1, d3quzd1, d3quzd2
    automated match to d1qrnd2
    complexed with nag, quv

Details for d3quzc2

PDB Entry: 3quz (more details), 2.3 Å

PDB Description: structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3quzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quzc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3quzc2:

Click to download the PDB-style file with coordinates for d3quzc2.
(The format of our PDB-style files is described here.)

Timeline for d3quzc2: