SCOPe 2.08: Domain d3quzc2: 3quz C:118-206

Lineage for d3quzc2 (3quz C:118-206)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (15 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)
Domain d3quzc2: 3quz C:118-206 [200407]
Other proteins in same PDB: d3quza1, d3quzb_, d3quzc1, d3quzd1, d3quzd2
automated match to d1qrnd2
complexed with nag, quv

Details for d3quzc2

PDB Entry: 3quz (more details), 2.3 Å

PDB Description: structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex

PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3quzc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quzc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3quzc2:

Click to download the PDB-style file with coordinates for d3quzc2.
(The format of our PDB-style files is described here.)

Timeline for d3quzc2: