Lineage for d3quza2 (3quz A:186-279)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1762660Protein automated matches [190374] (14 species)
    not a true protein
  7. 1763627Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)
  8. 1763820Domain d3quza2: 3quz A:186-279 [200405]
    Other proteins in same PDB: d3quza1, d3quzb_, d3quzc1, d3quzd1, d3quzd2
    automated match to d1onqa1
    complexed with nag, quv

Details for d3quza2

PDB Entry: 3quz (more details), 2.3 Å

PDB Description: structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3quza2:

Sequence, based on SEQRES records: (download)

>d3quza2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilyw

Sequence, based on observed residues (ATOM records): (download)

>d3quza2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatld
veageeaglacrvkhsslggqdiilyw

SCOPe Domain Coordinates for d3quza2:

Click to download the PDB-style file with coordinates for d3quza2.
(The format of our PDB-style files is described here.)

Timeline for d3quza2: