SCOPe 2.07: Domain d3quza1: 3quz A:7-185

Lineage for d3quza1 (3quz A:7-185)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (70 PDB entries)

8. Domain d3quza1: 3quz A:7-185 [200404]
   Other proteins in same PDB: d3quza2, d3quzb_, d3quzc1, d3quzc2, d3quzd1, d3quzd2
   automated match to d1onqa2
   complexed with nag, quv

Details for d3quza1

PDB Entry: 3quz, 2.3 Å

PDB Description: structure of the mouse cd1d-nu-alpha-galcer-inkt tcr complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3quza1:

Sequence; same for both SEQRES and ATOM records:

>d3quza1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3quza1:

• d3quza1 first appeared in SCOPe 2.03
  
• d3quza1 appears in SCOPe 2.06
  
• d3quza1 appears in the current release, SCOPe 2.08