SCOPe 2.07: Domain d3quyd1: 3quy D:2-112

Lineage for d3quyd1 (3quy D:2-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d3quyd1: 3quy D:2-112 [200402]
   Other proteins in same PDB: d3quya1, d3quya2, d3quyb_, d3quyc1, d3quyc2, d3quyd2
   automated match to d1lp9f1
   complexed with gol, nag, quy

Details for d3quyd1

PDB Entry: 3quy, 2.25 Å

PDB Description: structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex

PDB Compounds: (D:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3quyd1:

Sequence; same for both SEQRES and ATOM records:

>d3quyd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip
dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle

Timeline for d3quyd1:

• d3quyd1 first appeared in SCOPe 2.03
  
• d3quyd1 appears in SCOPe 2.06
  
• d3quyd1 appears in the current release, SCOPe 2.08