![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (24 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries) |
![]() | Domain d3quyd1: 3quy D:2-112 [200402] Other proteins in same PDB: d3quya1, d3quya2, d3quyb_, d3quyc1, d3quyc2, d3quyd2 automated match to d1lp9f1 complexed with gol, nag, quy |
PDB Entry: 3quy (more details), 2.25 Å
SCOPe Domain Sequences for d3quyd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3quyd1 b.1.1.1 (D:2-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]} aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle
Timeline for d3quyd1: