SCOPe 2.05: Domain d3quyc2: 3quy C:118-206

Lineage for d3quyc2 (3quy C:118-206)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3quyc2: 3quy C:118-206 [200401]
   Other proteins in same PDB: d3quya1, d3quyb_, d3quyc1, d3quyd1, d3quyd2
   automated match to d1qrnd2
   complexed with gol, nag, quy

Details for d3quyc2

PDB Entry: 3quy, 2.25 Å

PDB Description: structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex

PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3quyc2:

Sequence, based on SEQRES records:

>d3quyc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3quyc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

Timeline for d3quyc2:

• d3quyc2 first appeared in SCOPe 2.03
  
• d3quyc2 appears in SCOPe 2.04
  
• d3quyc2 appears in SCOPe 2.06
  
• d3quyc2 appears in the current release, SCOPe 2.08