Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry) |
Domain d1lmkg1: 1lmk G:2-127 [20040] |
PDB Entry: 1lmk (more details), 2.6 Å
SCOP Domain Sequences for d1lmkg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lmkg1 b.1.1.1 (G:2-127) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain} vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs sggggs
Timeline for d1lmkg1: