![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d3quya2: 3quy A:186-279 [200399] Other proteins in same PDB: d3quya1, d3quyb_, d3quyc1, d3quyd1, d3quyd2 automated match to d1onqa1 complexed with gol, nag, quy |
PDB Entry: 3quy (more details), 2.25 Å
SCOPe Domain Sequences for d3quya2:
Sequence, based on SEQRES records: (download)
>d3quya2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d3quya2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvprqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqatl dveageeaglacrvkhsslggqdiilyw
Timeline for d3quya2: