Lineage for d3quxc2 (3qux C:118-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2363630Species Mouse (Mus musculus) [TaxId:10090] [224855] (654 PDB entries)
  8. 2364175Domain d3quxc2: 3qux C:118-206 [200395]
    Other proteins in same PDB: d3quxa1, d3quxb_, d3quxc1, d3quxd1, d3quxd2
    automated match to d1qrnd2
    complexed with nag, qux

Details for d3quxc2

PDB Entry: 3qux (more details), 2.91 Å

PDB Description: structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex
PDB Compounds: (C:) Valpha14 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3quxc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quxc2 b.1.1.2 (C:118-206) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3quxc2:

Click to download the PDB-style file with coordinates for d3quxc2.
(The format of our PDB-style files is described here.)

Timeline for d3quxc2: